PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023414m
Common NameCARUB_v10023414mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 386aa    MW: 42801.2 Da    PI: 7.2101
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023414mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-165499147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++e d  l ++v++ G+++W++I+r ++ gR++k+c++rw + 
  Carubv10023414m 54 KGPWSPEQDAALTRLVTKCGPRNWTLISRGIP-GRSGKSCRLRWCNQ 99
                     79******************************.***********985 PP

2Myb_DNA-binding48.71.7e-15106149146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++++ eEd  +  a++ +G++ W+ Ia+ ++ gRt++ +k++w++
  Carubv10023414m 106 KKPFSDEEDHMIMSAHAVHGNK-WAVIAKLLP-GRTDNAIKNHWNS 149
                      689*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.44449104IPR017930Myb domain
SuperFamilySSF466899.36E-3051147IPR009057Homeodomain-like
SMARTSM007171.1E-1353102IPR001005SANT/Myb domain
PfamPF002498.0E-155499IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2355107IPR009057Homeodomain-like
CDDcd001671.12E-125698No hitNo description
SMARTSM007172.3E-13105153IPR001005SANT/Myb domain
PROSITE profilePS5129420.009105155IPR017930Myb domain
PfamPF002494.2E-14106149IPR001005SANT/Myb domain
CDDcd001671.37E-9108151No hitNo description
Gene3DG3DSA:1.10.10.603.2E-23108154IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MNAAISHPPE LMPSLNLSTG CDGSEDAINA AVEEELAELA KGDSSSGGGR SKVKGPWSPE  60
QDAALTRLVT KCGPRNWTLI SRGIPGRSGK SCRLRWCNQL DPCLKKKPFS DEEDHMIMSA  120
HAVHGNKWAV IAKLLPGRTD NAIKNHWNSS LRRKPADVWK DHQGIPSTEI YQVHPSKVRK  180
ISNETSPREH LPREEVNSFM APVVNDDQMA NEPNEPLLEQ KSKPDVYRPV ARMGAFSVCK  240
QGYMNHHMAP CEGPLVHASR PGSLAGKFLQ SLCYEPIVPS KCGRGCCNHS DNKTLCNSVL  300
GPEFVDYEEH SSAELDQELI SISTDLNNIA WIRTGSDNKY FKEAEQSLKA DDQYHHREYA  360
HPKFTGMVNN SVSSQMLRQD LRALN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-37531543104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294397.10.0hypothetical protein CARUB_v10023414mg
TrEMBLR0HPT00.0R0HPT0_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0004_25720.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G39880.11e-172myb domain protein 25